PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10819A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 273aa    MW: 29374.8 Da    PI: 8.2568
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10819AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_10819A 14 KGAWTKEEDQRLVAYIKAHGEGCWRALPKAAGLQRCGKSCRLRWINYL 61
                               79********************************************97 PP

2Myb_DNA-binding57.53.1e-1867111147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg++T eEd+ ++++++ lG++ W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_10819A  67 RGNFTDEEDDTIIKLHQILGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                                89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.037961IPR017930Myb domain
SuperFamilySSF466895.39E-3013108IPR009057Homeodomain-like
SMARTSM007173.6E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001671.46E-111661No hitNo description
PROSITE profilePS5129427.90662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2865117IPR009057Homeodomain-like
SMARTSM007171.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001671.32E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRAL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDDTIIK LHQILGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLIARG  120
IDPKTHRPLN ETAAAAAPST HRPQDNDDLA RRPSCCSPET SGGAGSSDEG SASGSLPPPE  180
TSSSQRQLVD KCIDLNLSIG LPQQQPSSSA PPPMRPQEAQ AGSSSMVSST TATVAGAGTS  240
SSTNSERERV CLCLNRLGLQ CDDEGCTSCG HG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM1569051e-145AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBankEU9639111e-145EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBankHQ8586921e-145HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977235.11e-110PREDICTED: myb-related protein Zm38-like
SwissprotP813952e-88MYB30_ANTMA; Myb-related protein 330
TrEMBLK3YEC21e-110K3YEC2_SETIT; Uncharacterized protein
STRINGSi012585m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-87myb domain protein 4